Loading...
Statistics
Advertisement

– where the quill & imagination meet –
www.twelfthlight.com/
- where the quill & imagination meet -

Twelfthlight.com

Advertisement
Twelfthlight.com is hosted in United States / San Francisco . Twelfthlight.com uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Twelfthlight.com

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Iframe
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Twelfthlight.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 277144717713896471454354943956581746789728
    • validFrom: 160614121400Z
    • validTo: 160912121400Z
    • validFrom_time_t: 1465906440
    • validTo_time_t: 1473682440
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 61:DB:7B:93:50:7D:7C:4D:43:46:77:00:17:F0:BD:DC:E3:5D:E5:1A
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:blog.twelixir.com, DNS:tls.automattic.com, DNS:tweikert.com, DNS:tweldongarrettblog.com, DNS:twelfontheshelf.com, DNS:twelftbeast.com, DNS:twelfthlight.com, DNS:twelfthnightacademy.net, DNS:twelfthnightclub.org, DNS:twelve12s.com, DNS:twelve2012.org, DNS:twelve37am.com, DNS:twelvec.com, DNS:twelveconf.com, DNS:twelvedollarbeers.com, DNS:twelveeightysixstudio.com, DNS:twelveinchesmag.com, DNS:twelvekey.com, DNS:twelvemilecreekfamilymedicine.com, DNS:twelvemilesfromalemon.com, DNS:twelvemonthproject.com, DNS:twelvemonthsabroad.com, DNS:twelvenineride.org, DNS:twelveonline.com, DNS:twelvepalettes.com, DNS:twelvepercentmusic.com, DNS:twelvepoles.com, DNS:www.tweldongarrettblog.com, DNS:www.twelfontheshelf.com, DNS:www.twelftbeast.com, DNS:www.twelfthlight.com, DNS:www.twelfthnightacademy.net, DNS:www.twelfthnightclub.org, DNS:www.twelve12s.com, DNS:www.twelve2012.org, DNS:www.twelve37am.com, DNS:www.twelvec.com, DNS:www.twelveconf.com, DNS:www.twelvedollarbeers.com, DNS:www.twelveeightysixstudio.com, DNS:www.twelveinchesmag.com, DNS:www.twelvekey.com, DNS:www.twelvemilecreekfamilymedicine.com, DNS:www.twelvemilesfromalemon.com, DNS:www.twelvemonthproject.com, DNS:www.twelvemonthsabroad.com, DNS:www.twelvenineride.org, DNS:www.twelveonline.com, DNS:www.twelvepalettes.com, DNS:www.twelvepercentmusic.com, DNS:www.twelvepoles.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Twelfthlight.com

Number of occurences: 12
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: p:domain_verify
    Content: fa95cdcb46b9d1fdd2bd72aa3acf0348
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #ffffff
  • Name: application-name
    Content: WordPress.com
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: - where the quill & imagination meet -
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: on WordPress.com
  • Name: description
    Content: - where the quill & imagination meet -

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns2.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Mon, 04 Jul 2016 22:48:08 GMT Content-Type: text/html Content-Length: 178 Location: https://twelfthlight.com/ X-ac: 3.fra _dfw X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Mon, 04 Jul 2016 22:48:09 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.fra _dfw

DNS

host: twelfthlight.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: twelfthlight.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.welfthlight.com, www.tqwelfthlight.com, www.qwelfthlight.com, www.tawelfthlight.com, www.awelfthlight.com, www.t welfthlight.com, www. welfthlight.com, www.twwelfthlight.com, www.wwelfthlight.com, www.tewelfthlight.com, www.ewelfthlight.com, www.tzwelfthlight.com, www.zwelfthlight.com, www.txwelfthlight.com, www.xwelfthlight.com, www.tcwelfthlight.com, www.cwelfthlight.com, www.telfthlight.com, www.tw elfthlight.com, www.t elfthlight.com, www.twcelfthlight.com, www.tcelfthlight.com, www.twelfthlight.com, www.telfthlight.com, www.twdelfthlight.com, www.tdelfthlight.com, www.twfelfthlight.com, www.tfelfthlight.com, www.twgelfthlight.com, www.tgelfthlight.com, www.twbelfthlight.com, www.tbelfthlight.com, www.twlfthlight.com, www.twexlfthlight.com, www.twxlfthlight.com, www.tweslfthlight.com, www.twslfthlight.com, www.twewlfthlight.com, www.twwlfthlight.com, www.twerlfthlight.com, www.twrlfthlight.com, www.tweflfthlight.com, www.twflfthlight.com, www.twevlfthlight.com, www.twvlfthlight.com, www.tweclfthlight.com, www.twclfthlight.com, www.tweqlfthlight.com, www.twqlfthlight.com, www.twealfthlight.com, www.twalfthlight.com, www.tweylfthlight.com, www.twylfthlight.com, www.twefthlight.com, www.twelufthlight.com, www.tweufthlight.com, www.twel8fthlight.com, www.twe8fthlight.com, www.twel9fthlight.com, www.twe9fthlight.com, www.tweljfthlight.com, www.twejfthlight.com, www.twel0fthlight.com, www.twe0fthlight.com, www.twelmfthlight.com, www.twemfthlight.com, www.twelpfthlight.com, www.twepfthlight.com, www.twelofthlight.com, www.tweofthlight.com, www.twelthlight.com, www.twelfqthlight.com, www.twelqthlight.com, www.twelfthlight.com, www.twelthlight.com, www.twelfathlight.com, www.twelathlight.com, www.twelfythlight.com, www.twelythlight.com, www.twelftthlight.com, www.tweltthlight.com, www.twelfgthlight.com, www.twelgthlight.com, www.twelfbthlight.com, www.twelbthlight.com, www.twelfwthlight.com, www.twelwthlight.com, www.twelfsthlight.com, www.twelsthlight.com, www.twelfdthlight.com, www.tweldthlight.com, www.twelfrthlight.com, www.twelrthlight.com, www.twelf3thlight.com, www.twel3thlight.com, www.twelf4thlight.com, www.twel4thlight.com, www.twelfhlight.com, www.twelftqhlight.com, www.twelfqhlight.com, www.twelftahlight.com, www.twelfahlight.com, www.twelft hlight.com, www.twelf hlight.com, www.twelftwhlight.com, www.twelfwhlight.com, www.twelftehlight.com, www.twelfehlight.com, www.twelftzhlight.com, www.twelfzhlight.com, www.twelftxhlight.com, www.twelfxhlight.com, www.twelftchlight.com, www.twelfchlight.com, www.twelftlight.com, www.twelfthelight.com, www.twelftelight.com, www.twelfthdlight.com, www.twelftdlight.com, www.twelfthclight.com, www.twelftclight.com, www.twelfthulight.com, www.twelftulight.com, www.twelfthjlight.com, www.twelftjlight.com, www.twelfthlight.com, www.twelftlight.com, www.twelfthblight.com, www.twelftblight.com, www.twelfthglight.com, www.twelftglight.com, www.twelfthight.com, www.twelfthluight.com, www.twelfthuight.com, www.twelfthl8ight.com, www.twelfth8ight.com, www.twelfthl9ight.com, www.twelfth9ight.com, www.twelfthljight.com, www.twelfthjight.com, www.twelfthl0ight.com, www.twelfth0ight.com, www.twelfthlmight.com, www.twelfthmight.com, www.twelfthlpight.com, www.twelfthpight.com, www.twelfthloight.com, www.twelfthoight.com, www.twelfthlght.com, www.twelfthlirght.com, www.twelfthlrght.com, www.twelfthlifght.com, www.twelfthlfght.com, www.twelfthlivght.com, www.twelfthlvght.com, www.twelfthlikght.com, www.twelfthlkght.com, www.twelfthli,ght.com, www.twelfthl,ght.com, www.twelfthlibght.com, www.twelfthlbght.com, www.twelfthligght.com, www.twelfthlgght.com, www.twelfthlitght.com, www.twelfthltght.com, www.twelfthliyght.com, www.twelfthlyght.com, www.twelfthliught.com, www.twelfthlught.com, www.twelfthlijght.com, www.twelfthljght.com, www.twelfthlimght.com, www.twelfthlmght.com, www.twelfthlinght.com, www.twelfthlnght.com,

Other websites we recently analyzed

  1. Plainfield United Methodist Church - Plainfield Indiana
    Dallas (United States) - 173.192.81.230
    Server software: nginx
    Technology: CloudFront, CSS, Google Font API, Html, Html5, Iframe, Javascript, Php, Share This Social Media Buttons
    Number of Javascript: 7
    Number of meta tags: 11
  2. EvolutionFit
    Arezzo (Italy) - 62.149.133.230
    G Analytics ID: UA-2889295-4
    Server software: squid/3.5.6
    Technology: CSS, Google Font API, Html, Javascript, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 2
  3. 45Ãë½²×ù£¬ÓµÓÐÄãµÄÈËÉú
    Hangzhou (China) - 112.124.186.97
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 6
  4. FMA - Future Media Architects
    San Antonio (United States) - 50.57.34.52
    Server software: Apache/2.2.15 (Red Hat)
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 7
    Number of meta tags: 1
  5. Nthulu Foundation: Main Website
    Established in Wigan, United Kingdom, in 2010, the Nthulu Foundation is a Christian based, non-governmental, not-for-profit body which undertakes charitable projects in the Dedza District of Malawi in Africa. The projects are focused on improving the lives of disadvantaged children through provision of quality infrastructure , facilities and educational materials to very poor schools of Dedza district to ensure that poor children in the area do not grow up to become poor adults.
    Scottsdale (United States) - 107.180.5.57
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Google Font API, Html, Javascript, DotNetNuke
    Number of Javascript: 2
    Number of meta tags: 2
  6. About us
    The company of horses is a business created by Emma Kurrels and Ben Hart. This two experts of equine métier decided to combine their skills. For...
    Newark (United States) - 192.99.99.51
    Server software: Apache/2.2.22 (Debian)
    Technology: CSS, Html, Html5
    Number of meta tags: 5
  7. thelearningrevolutionblog.com
    thelearningrevolutionblog.com
    Scottsdale (United States) - 50.63.202.28
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 1
  8. featherrooms.com
    Germany - 217.160.230.225
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  9. Matt Finish Productions – Motor based video
    United Kingdom - 94.229.164.219
    Server software: Apache
    Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 5
    Number of meta tags: 2
  10. SimpleSoft - strony www, portale, programy dedykowane, systemy crm, pozycjonowanie - O firmie
    Test dla rss
    Germany - 46.4.156.216
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 4

Check Other Websites