Loading...
Statistics
Advertisement

– where the quill & imagination meet –
www.twelfthlight.com/
- where the quill & imagination meet -

Twelfthlight.com

Advertisement
Twelfthlight.com is hosted in United States / San Francisco . Twelfthlight.com uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Twelfthlight.com

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Iframe
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Twelfthlight.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 277144717713896471454354943956581746789728
    • validFrom: 160614121400Z
    • validTo: 160912121400Z
    • validFrom_time_t: 1465906440
    • validTo_time_t: 1473682440
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 61:DB:7B:93:50:7D:7C:4D:43:46:77:00:17:F0:BD:DC:E3:5D:E5:1A
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:blog.twelixir.com, DNS:tls.automattic.com, DNS:tweikert.com, DNS:tweldongarrettblog.com, DNS:twelfontheshelf.com, DNS:twelftbeast.com, DNS:twelfthlight.com, DNS:twelfthnightacademy.net, DNS:twelfthnightclub.org, DNS:twelve12s.com, DNS:twelve2012.org, DNS:twelve37am.com, DNS:twelvec.com, DNS:twelveconf.com, DNS:twelvedollarbeers.com, DNS:twelveeightysixstudio.com, DNS:twelveinchesmag.com, DNS:twelvekey.com, DNS:twelvemilecreekfamilymedicine.com, DNS:twelvemilesfromalemon.com, DNS:twelvemonthproject.com, DNS:twelvemonthsabroad.com, DNS:twelvenineride.org, DNS:twelveonline.com, DNS:twelvepalettes.com, DNS:twelvepercentmusic.com, DNS:twelvepoles.com, DNS:www.tweldongarrettblog.com, DNS:www.twelfontheshelf.com, DNS:www.twelftbeast.com, DNS:www.twelfthlight.com, DNS:www.twelfthnightacademy.net, DNS:www.twelfthnightclub.org, DNS:www.twelve12s.com, DNS:www.twelve2012.org, DNS:www.twelve37am.com, DNS:www.twelvec.com, DNS:www.twelveconf.com, DNS:www.twelvedollarbeers.com, DNS:www.twelveeightysixstudio.com, DNS:www.twelveinchesmag.com, DNS:www.twelvekey.com, DNS:www.twelvemilecreekfamilymedicine.com, DNS:www.twelvemilesfromalemon.com, DNS:www.twelvemonthproject.com, DNS:www.twelvemonthsabroad.com, DNS:www.twelvenineride.org, DNS:www.twelveonline.com, DNS:www.twelvepalettes.com, DNS:www.twelvepercentmusic.com, DNS:www.twelvepoles.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Twelfthlight.com

Number of occurences: 12
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: p:domain_verify
    Content: fa95cdcb46b9d1fdd2bd72aa3acf0348
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #ffffff
  • Name: application-name
    Content: WordPress.com
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: - where the quill & imagination meet -
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: on WordPress.com
  • Name: description
    Content: - where the quill & imagination meet -

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns2.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Mon, 04 Jul 2016 22:48:08 GMT Content-Type: text/html Content-Length: 178 Location: https://twelfthlight.com/ X-ac: 3.fra _dfw X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Mon, 04 Jul 2016 22:48:09 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.fra _dfw

DNS

host: twelfthlight.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: twelfthlight.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.welfthlight.com, www.tqwelfthlight.com, www.qwelfthlight.com, www.tawelfthlight.com, www.awelfthlight.com, www.t welfthlight.com, www. welfthlight.com, www.twwelfthlight.com, www.wwelfthlight.com, www.tewelfthlight.com, www.ewelfthlight.com, www.tzwelfthlight.com, www.zwelfthlight.com, www.txwelfthlight.com, www.xwelfthlight.com, www.tcwelfthlight.com, www.cwelfthlight.com, www.telfthlight.com, www.tw elfthlight.com, www.t elfthlight.com, www.twcelfthlight.com, www.tcelfthlight.com, www.twelfthlight.com, www.telfthlight.com, www.twdelfthlight.com, www.tdelfthlight.com, www.twfelfthlight.com, www.tfelfthlight.com, www.twgelfthlight.com, www.tgelfthlight.com, www.twbelfthlight.com, www.tbelfthlight.com, www.twlfthlight.com, www.twexlfthlight.com, www.twxlfthlight.com, www.tweslfthlight.com, www.twslfthlight.com, www.twewlfthlight.com, www.twwlfthlight.com, www.twerlfthlight.com, www.twrlfthlight.com, www.tweflfthlight.com, www.twflfthlight.com, www.twevlfthlight.com, www.twvlfthlight.com, www.tweclfthlight.com, www.twclfthlight.com, www.tweqlfthlight.com, www.twqlfthlight.com, www.twealfthlight.com, www.twalfthlight.com, www.tweylfthlight.com, www.twylfthlight.com, www.twefthlight.com, www.twelufthlight.com, www.tweufthlight.com, www.twel8fthlight.com, www.twe8fthlight.com, www.twel9fthlight.com, www.twe9fthlight.com, www.tweljfthlight.com, www.twejfthlight.com, www.twel0fthlight.com, www.twe0fthlight.com, www.twelmfthlight.com, www.twemfthlight.com, www.twelpfthlight.com, www.twepfthlight.com, www.twelofthlight.com, www.tweofthlight.com, www.twelthlight.com, www.twelfqthlight.com, www.twelqthlight.com, www.twelfthlight.com, www.twelthlight.com, www.twelfathlight.com, www.twelathlight.com, www.twelfythlight.com, www.twelythlight.com, www.twelftthlight.com, www.tweltthlight.com, www.twelfgthlight.com, www.twelgthlight.com, www.twelfbthlight.com, www.twelbthlight.com, www.twelfwthlight.com, www.twelwthlight.com, www.twelfsthlight.com, www.twelsthlight.com, www.twelfdthlight.com, www.tweldthlight.com, www.twelfrthlight.com, www.twelrthlight.com, www.twelf3thlight.com, www.twel3thlight.com, www.twelf4thlight.com, www.twel4thlight.com, www.twelfhlight.com, www.twelftqhlight.com, www.twelfqhlight.com, www.twelftahlight.com, www.twelfahlight.com, www.twelft hlight.com, www.twelf hlight.com, www.twelftwhlight.com, www.twelfwhlight.com, www.twelftehlight.com, www.twelfehlight.com, www.twelftzhlight.com, www.twelfzhlight.com, www.twelftxhlight.com, www.twelfxhlight.com, www.twelftchlight.com, www.twelfchlight.com, www.twelftlight.com, www.twelfthelight.com, www.twelftelight.com, www.twelfthdlight.com, www.twelftdlight.com, www.twelfthclight.com, www.twelftclight.com, www.twelfthulight.com, www.twelftulight.com, www.twelfthjlight.com, www.twelftjlight.com, www.twelfthlight.com, www.twelftlight.com, www.twelfthblight.com, www.twelftblight.com, www.twelfthglight.com, www.twelftglight.com, www.twelfthight.com, www.twelfthluight.com, www.twelfthuight.com, www.twelfthl8ight.com, www.twelfth8ight.com, www.twelfthl9ight.com, www.twelfth9ight.com, www.twelfthljight.com, www.twelfthjight.com, www.twelfthl0ight.com, www.twelfth0ight.com, www.twelfthlmight.com, www.twelfthmight.com, www.twelfthlpight.com, www.twelfthpight.com, www.twelfthloight.com, www.twelfthoight.com, www.twelfthlght.com, www.twelfthlirght.com, www.twelfthlrght.com, www.twelfthlifght.com, www.twelfthlfght.com, www.twelfthlivght.com, www.twelfthlvght.com, www.twelfthlikght.com, www.twelfthlkght.com, www.twelfthli,ght.com, www.twelfthl,ght.com, www.twelfthlibght.com, www.twelfthlbght.com, www.twelfthligght.com, www.twelfthlgght.com, www.twelfthlitght.com, www.twelfthltght.com, www.twelfthliyght.com, www.twelfthlyght.com, www.twelfthliught.com, www.twelfthlught.com, www.twelfthlijght.com, www.twelfthljght.com, www.twelfthlimght.com, www.twelfthlmght.com, www.twelfthlinght.com, www.twelfthlnght.com,

Other websites we recently analyzed

  1. Armadillo Dollar, protects against rfid hacking with rfid shield protection
    An rfid shield to protect against invisible rfid identity theft from rfid hacking of rfid tags on debit and credit cards, door access and more
    Scottsdale (United States) - 184.168.221.19
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 2
  2. Kids Tackling Hunger for Kids
    San Antonio (United States) - 69.20.92.137
    Server software: Microsoft-IIS/7.5
    Technology: PayPal, CSS, Flexslider, Google Font API, Html, Html5, Javascript, Php, Google Analytics, Facebook Box
    Number of Javascript: 11
    Number of meta tags: 2
  3. Brow Beauty
    United States - 75.98.17.74
    Server software: Webs.com/1.0
    Technology: CSS, Google Font API, Html, Html5, Javascript, Google Analytics, Facebook Box
    Number of Javascript: 6
    Number of meta tags: 5
  4. О КОМПАНИИ - Мебель МИРТА Южно-Сахалинск
    Dublin (Ireland) - 54.171.224.48
    G Analytics ID: UA-54647672-2
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, Php, Google Analytics, LiveInternet counter
    Number of Javascript: 1
    Number of meta tags: 3
  5. Body Of Proof Wiki - Wikia
    Body Of Proof Wiki is a community site that anyone can contribute to. Discover, share and add your knowledge!
    United States - 23.235.33.194
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, SVG, comScore, Quantcast Measurement
    Number of Javascript: 19
    Number of meta tags: 11
  6. fleetingglimp.se.net
    San Jose (United States) - 205.164.14.88
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. wholebodytravel.com
    Scottsdale (United States) - 184.168.221.35
    Server software: squid/3.5.12
    Technology: Html, Html5, Iframe
  8. Wohnungen in Halle Saale / Neustadt - GWG Familienwohnung
    GWG Familienwohnung bietet optimale Wohnungsangebote Halle Saale + Halle Neustadt - Günstige 3 Raum Wohnungen - 4 Raum Wohnungen - 5 Raum Wohnungen mieten
    Berlin (Germany) - 212.122.42.232
    G Analytics ID: UA-47222042-3
    Server software: Microsoft-IIS/8.0
    Technology: CSS, Google Font API, Html, Html5, Javascript, Lightbox, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 8
    Number of meta tags: 8
  9. USA Stair, LLC. Spiral Stairway
    Spiral stairs and spiral staircase kits in steel, wood, aluminum and galvanized steel. Spiral stairs for interior circular staircases, exterior stairs and deck installations.
    Burlington (United States) - 66.96.160.131
    Server software: Apache/2
    Technology: Php, Swf Object
    Number of meta tags: 6
  10. fz.by
    Amsterdam (Netherlands) - 93.170.104.146
    Server software: Apache/2.2.22 (Debian)
    Technology: CSS, Html, Javascript, LiveInternet counter
    Number of meta tags: 1

Check Other Websites