Loading...
Statistics
Advertisement

– where the quill & imagination meet –
www.twelfthlight.com/
- where the quill & imagination meet -

Twelfthlight.com

Advertisement
Conversion Technology Metas Server
Twelfthlight.com is hosted in United States / San Francisco . Twelfthlight.com uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Twelfthlight.com

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Iframe
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Twelfthlight.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 277144717713896471454354943956581746789728
    • validFrom: 160614121400Z
    • validTo: 160912121400Z
    • validFrom_time_t: 1465906440
    • validTo_time_t: 1473682440
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 61:DB:7B:93:50:7D:7C:4D:43:46:77:00:17:F0:BD:DC:E3:5D:E5:1A
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:blog.twelixir.com, DNS:tls.automattic.com, DNS:tweikert.com, DNS:tweldongarrettblog.com, DNS:twelfontheshelf.com, DNS:twelftbeast.com, DNS:twelfthlight.com, DNS:twelfthnightacademy.net, DNS:twelfthnightclub.org, DNS:twelve12s.com, DNS:twelve2012.org, DNS:twelve37am.com, DNS:twelvec.com, DNS:twelveconf.com, DNS:twelvedollarbeers.com, DNS:twelveeightysixstudio.com, DNS:twelveinchesmag.com, DNS:twelvekey.com, DNS:twelvemilecreekfamilymedicine.com, DNS:twelvemilesfromalemon.com, DNS:twelvemonthproject.com, DNS:twelvemonthsabroad.com, DNS:twelvenineride.org, DNS:twelveonline.com, DNS:twelvepalettes.com, DNS:twelvepercentmusic.com, DNS:twelvepoles.com, DNS:www.tweldongarrettblog.com, DNS:www.twelfontheshelf.com, DNS:www.twelftbeast.com, DNS:www.twelfthlight.com, DNS:www.twelfthnightacademy.net, DNS:www.twelfthnightclub.org, DNS:www.twelve12s.com, DNS:www.twelve2012.org, DNS:www.twelve37am.com, DNS:www.twelvec.com, DNS:www.twelveconf.com, DNS:www.twelvedollarbeers.com, DNS:www.twelveeightysixstudio.com, DNS:www.twelveinchesmag.com, DNS:www.twelvekey.com, DNS:www.twelvemilecreekfamilymedicine.com, DNS:www.twelvemilesfromalemon.com, DNS:www.twelvemonthproject.com, DNS:www.twelvemonthsabroad.com, DNS:www.twelvenineride.org, DNS:www.twelveonline.com, DNS:www.twelvepalettes.com, DNS:www.twelvepercentmusic.com, DNS:www.twelvepoles.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Twelfthlight.com

Number of occurences: 12
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: p:domain_verify
    Content: fa95cdcb46b9d1fdd2bd72aa3acf0348
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #ffffff
  • Name: application-name
    Content: WordPress.com
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: - where the quill & imagination meet -
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: on WordPress.com
  • Name: description
    Content: - where the quill & imagination meet -

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns2.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Mon, 04 Jul 2016 22:48:08 GMT Content-Type: text/html Content-Length: 178 Location: https://twelfthlight.com/ X-ac: 3.fra _dfw X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Mon, 04 Jul 2016 22:48:09 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.fra _dfw

DNS

host: twelfthlight.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: twelfthlight.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: twelfthlight.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.welfthlight.com, www.tqwelfthlight.com, www.qwelfthlight.com, www.tawelfthlight.com, www.awelfthlight.com, www.t welfthlight.com, www. welfthlight.com, www.twwelfthlight.com, www.wwelfthlight.com, www.tewelfthlight.com, www.ewelfthlight.com, www.tzwelfthlight.com, www.zwelfthlight.com, www.txwelfthlight.com, www.xwelfthlight.com, www.tcwelfthlight.com, www.cwelfthlight.com, www.telfthlight.com, www.tw elfthlight.com, www.t elfthlight.com, www.twcelfthlight.com, www.tcelfthlight.com, www.twelfthlight.com, www.telfthlight.com, www.twdelfthlight.com, www.tdelfthlight.com, www.twfelfthlight.com, www.tfelfthlight.com, www.twgelfthlight.com, www.tgelfthlight.com, www.twbelfthlight.com, www.tbelfthlight.com, www.twlfthlight.com, www.twexlfthlight.com, www.twxlfthlight.com, www.tweslfthlight.com, www.twslfthlight.com, www.twewlfthlight.com, www.twwlfthlight.com, www.twerlfthlight.com, www.twrlfthlight.com, www.tweflfthlight.com, www.twflfthlight.com, www.twevlfthlight.com, www.twvlfthlight.com, www.tweclfthlight.com, www.twclfthlight.com, www.tweqlfthlight.com, www.twqlfthlight.com, www.twealfthlight.com, www.twalfthlight.com, www.tweylfthlight.com, www.twylfthlight.com, www.twefthlight.com, www.twelufthlight.com, www.tweufthlight.com, www.twel8fthlight.com, www.twe8fthlight.com, www.twel9fthlight.com, www.twe9fthlight.com, www.tweljfthlight.com, www.twejfthlight.com, www.twel0fthlight.com, www.twe0fthlight.com, www.twelmfthlight.com, www.twemfthlight.com, www.twelpfthlight.com, www.twepfthlight.com, www.twelofthlight.com, www.tweofthlight.com, www.twelthlight.com, www.twelfqthlight.com, www.twelqthlight.com, www.twelfthlight.com, www.twelthlight.com, www.twelfathlight.com, www.twelathlight.com, www.twelfythlight.com, www.twelythlight.com, www.twelftthlight.com, www.tweltthlight.com, www.twelfgthlight.com, www.twelgthlight.com, www.twelfbthlight.com, www.twelbthlight.com, www.twelfwthlight.com, www.twelwthlight.com, www.twelfsthlight.com, www.twelsthlight.com, www.twelfdthlight.com, www.tweldthlight.com, www.twelfrthlight.com, www.twelrthlight.com, www.twelf3thlight.com, www.twel3thlight.com, www.twelf4thlight.com, www.twel4thlight.com, www.twelfhlight.com, www.twelftqhlight.com, www.twelfqhlight.com, www.twelftahlight.com, www.twelfahlight.com, www.twelft hlight.com, www.twelf hlight.com, www.twelftwhlight.com, www.twelfwhlight.com, www.twelftehlight.com, www.twelfehlight.com, www.twelftzhlight.com, www.twelfzhlight.com, www.twelftxhlight.com, www.twelfxhlight.com, www.twelftchlight.com, www.twelfchlight.com, www.twelftlight.com, www.twelfthelight.com, www.twelftelight.com, www.twelfthdlight.com, www.twelftdlight.com, www.twelfthclight.com, www.twelftclight.com, www.twelfthulight.com, www.twelftulight.com, www.twelfthjlight.com, www.twelftjlight.com, www.twelfthlight.com, www.twelftlight.com, www.twelfthblight.com, www.twelftblight.com, www.twelfthglight.com, www.twelftglight.com, www.twelfthight.com, www.twelfthluight.com, www.twelfthuight.com, www.twelfthl8ight.com, www.twelfth8ight.com, www.twelfthl9ight.com, www.twelfth9ight.com, www.twelfthljight.com, www.twelfthjight.com, www.twelfthl0ight.com, www.twelfth0ight.com, www.twelfthlmight.com, www.twelfthmight.com, www.twelfthlpight.com, www.twelfthpight.com, www.twelfthloight.com, www.twelfthoight.com, www.twelfthlght.com, www.twelfthlirght.com, www.twelfthlrght.com, www.twelfthlifght.com, www.twelfthlfght.com, www.twelfthlivght.com, www.twelfthlvght.com, www.twelfthlikght.com, www.twelfthlkght.com, www.twelfthli,ght.com, www.twelfthl,ght.com, www.twelfthlibght.com, www.twelfthlbght.com, www.twelfthligght.com, www.twelfthlgght.com, www.twelfthlitght.com, www.twelfthltght.com, www.twelfthliyght.com, www.twelfthlyght.com, www.twelfthliught.com, www.twelfthlught.com, www.twelfthlijght.com, www.twelfthljght.com, www.twelfthlimght.com, www.twelfthlmght.com, www.twelfthlinght.com, www.twelfthlnght.com,

Other websites we recently analyzed

  1. VISITARE SANTO DOMINGO - Visite guidate a Santo Domingo - Monumenti, Storia e Cultura
    Visite guidate a Santo Domingo - Monumenti, Storia e Cultura
    Italy - 217.64.195.236
    G Analytics ID: UA-42782412-8
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, SVG, Google Analytics, Wordpress, Facebook Box
    Number of Javascript: 12
    Number of meta tags: 8
  2. otomobilinikirala.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
    Cyprus - 93.89.226.17
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html
  3. AMAC - AMAC ALBACETE
    Soy una asociación sin ánimo de lucro, existo para ayudarte a superar el cáncer de mama y ginecológico, para luchar por tus derechos y combatir el cáncer.
    Madrid (Spain) - 84.124.11.210
    G Analytics ID: UA-76157734-1
    Server software: nginx
    Technology: PayPal, CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, SVG, Google Analytics, Wordpress, Facebook Box
    Number of Javascript: 21
    Number of meta tags: 10
  4. hanoiwalkingtours.net
    Hanoi (Vietnam) - 103.28.39.121
    Server software: Apache/2
    Technology: Html
  5. stnchart.com
    Austin (United States) - 209.99.40.219
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  6. Pandora Charms UK Sale, Jewellery gift of Mother's Day | Black Friday | Cyber Monday | Valentine's Day | Christmas - discountpandoracharmsukz.eu
    Pandora Charms UK Sale, Buy Pandora® Charms & Bracelets Online Now, Full Pandora Range in Stock. Vast Selection of Quality Pandora Jewellery, Celebrate a Black Friday gift that means more - express your love and gratitude. Free UK Delivery On Orders Over £50.
    Istanbul (Turkey) - 167.160.12.84
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 6
  7. Stralsunder Line Dancer - Home - Stralsunder Line Dancer
    Stralsunder Line Dancer, Stralsund, Line Dance, Linedance, Stralsunder Linedancer, Manfred Decker, Decker
    Germany - 85.114.130.45
    Server software: Apache
    Technology: CSS, Html, Html5, jQuery Colorbox, jQuery UI, MediaElement, Php, Swf Object
    Number of Javascript: 6
    Number of meta tags: 6
  8. xn--zahnarztpraxis-wrzburg-7lc.info
    Germany - 85.13.146.57
    Server software: Apache
    Technology: Php
  9. Laugier Design
    Germany - 87.106.166.62
    Server software: Apache
    Technology: Html5
    Number of meta tags: 1
  10. Welcome to ABSINTHE.CO
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 2

Check Other Websites